bigcliffyurr bigcliffyurr
  • 11-06-2021
  • Spanish
contestada

Can someone plzzz helppp meeeee

Can someone plzzz helppp meeeee class=

Respuesta :

daisyredmare daisyredmare
  • 11-06-2021
1 Enojada
2. Cansado
3. Decoradas
4. Preparando
Now I am a fluent Spanish speaker but I do not know whether they have acentos or not :DDD
Answer Link

Otras preguntas

302071 Set D Q.No. 9 Write down the structure of secondaryhaloalkane of C3H7X. What happen when the secondaryhaloalkane is heated with Na in presence of dry eth
The vampire's eyes were burning coals, bright and red. “What firgurative language is it”
Which of the following is a carbohydrate? * 5 points DNA Insulin Wax Sucrose All the above
What evidence did you see of the microscope resolving power
Find an equation of the line that has a slope of 10 and a y intercept of 1. Write your answer in the form y = mx + b.
solve 3(t-1)=9+t please answer fast cuz i will give u 5 stars
The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the protein
When experimenting whether the rate at which water freezes depends on the shape of the container. What would be the the independent variable? What is the depend
Help! What is the answer to this question?​
( -6p - 8 ) - ( 2p - 6 ) plz :)